CLCN6 antibody (C-Term)

Catalog No. ABIN630094

Product Details anti-CLCN6 Antibody

Target: CLCN6 (Chloride Channel, Voltage-Sensitive 6 (CLCN6))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CLCN6 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CLCN6 antibody was raised against the C terminal of CLCN6

Purification: Purified

Immunogen: CLCN6 antibody was raised using the C terminal of CLCN6 corresponding to a region with amino acids PQFQSISLRKIQFNFPYFRSDRDKRDFVSAGAAAGVAAAFGAPIGGTLFS

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CLCN6 Blocking Peptide, catalog no. 33R-7295, is also available for use as a blocking control in assays to test for specificity of this CLCN6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLCN6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CLCN6

Target: CLCN6 (Chloride Channel, Voltage-Sensitive 6 (CLCN6))

Alternative Name: CLCN6 (CLCN6 Products)

Synonyms: CLC-6 antibody, AI850629 antibody, CLCN6 antibody, wu:fb95f01 antibody, DKFZp469B244 antibody, DKFZp469L0417 antibody, chloride voltage-gated channel 6 antibody, chloride channel, voltage-sensitive 6 antibody, chloride channel 6 antibody, chloride transport protein 6 antibody, CLCN6 antibody, Clcn6 antibody, clcn6 antibody, LOC579870 antibody

Background: The CLCN family of voltage-dependent chloride channel genes comprises nine members (CLCN1-7, Ka and Kb) which demonstrate quite diverse functional characteristics while sharing significant sequence homology. Chloride channel 6 and 7 belong to a subbranch of this family. Chloride channel 6 has four different alternatively spliced transcript variants. This gene is in close vicinity to two other kidney-specific chloride channel genes, CLCNKA and CLCNKB.

Molecular Weight: 39 kDa (MW of target protein)