KCNQ2 antibody (Middle Region)

Catalog No. ABIN630098

Product Details anti-KCNQ2 Antibody

Target: KCNQ2 (Potassium Voltage-Gated Channel, KQT-Like Subfamily, Member 2 (KCNQ2))

Binding Specificity: Middle Region

Reactivity: Rat, Human, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KCNQ2 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: KCNQ2 antibody was raised against the middle region of KCNQ2

Purification: Purified

Immunogen: KCNQ2 antibody was raised using the middle region of KCNQ2 corresponding to a region with amino acids GNVFATSALRSLRFLQILRMIRMDRRGGTWKLLGSVVYAHSKELVTAWYI

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KCNQ2 Blocking Peptide, catalog no. 33R-3461, is also available for use as a blocking control in assays to test for specificity of this KCNQ2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNQ2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KCNQ2

Target: KCNQ2 (Potassium Voltage-Gated Channel, KQT-Like Subfamily, Member 2 (KCNQ2))

Alternative Name: KCNQ2 (KCNQ2 Products)

Synonyms: BFNC antibody, BFNS1 antibody, EBN antibody, EBN1 antibody, EIEE7 antibody, ENB1 antibody, HNSPC antibody, KCNA11 antibody, KV7.2 antibody, KVEBN1 antibody, KQT2 antibody, Nmf134 antibody, mKQT2.3 antibody, mKQT2.4 antibody, zgc:171872 antibody, potassium voltage-gated channel subfamily Q member 2 antibody, potassium voltage-gated channel, subfamily Q, member 2 antibody, potassium voltage-gated channel subfamily KQT member 2 antibody, potassium voltage-gated channel, KQT-like subfamily, member 2a antibody, KCNQ2 antibody, Kcnq2 antibody, LOC100537363 antibody, kcnq2a antibody

Background: The M channel is a slowly activating and deactivating potassium channel that plays a critical role in the regulation of neuronal excitability. The M channel is formed by the association of the protein encoded by the KCNQ2 gene and a related protein encoded by the KCNQ3 gene, both integral membrane proteins. M channel currents are inhibited by M1 muscarinic acetylcholine receptors and activated by retigabine, a novel anti-convulsant drug. Defects in KCNQ2 are a cause of benign familial neonatal convulsions type 1 (BFNC), also known as epilepsy, benign neonatal type 1 (EBN1).

Molecular Weight: 43 kDa (MW of target protein)