KCNQ2 antibody (Middle Region)
-
- Target See all KCNQ2 Antibodies
- KCNQ2 (Potassium Voltage-Gated Channel, KQT-Like Subfamily, Member 2 (KCNQ2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Rat, Human, Mouse, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This KCNQ2 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- KCNQ2 antibody was raised against the middle region of KCNQ2
- Purification
- Purified
- Immunogen
- KCNQ2 antibody was raised using the middle region of KCNQ2 corresponding to a region with amino acids GNVFATSALRSLRFLQILRMIRMDRRGGTWKLLGSVVYAHSKELVTAWYI
- Top Product
- Discover our top product KCNQ2 Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
KCNQ2 Blocking Peptide, catalog no. 33R-3461, is also available for use as a blocking control in assays to test for specificity of this KCNQ2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNQ2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KCNQ2 (Potassium Voltage-Gated Channel, KQT-Like Subfamily, Member 2 (KCNQ2))
- Alternative Name
- KCNQ2 (KCNQ2 Products)
- Synonyms
- BFNC antibody, BFNS1 antibody, EBN antibody, EBN1 antibody, EIEE7 antibody, ENB1 antibody, HNSPC antibody, KCNA11 antibody, KV7.2 antibody, KVEBN1 antibody, KQT2 antibody, Nmf134 antibody, mKQT2.3 antibody, mKQT2.4 antibody, zgc:171872 antibody, potassium voltage-gated channel subfamily Q member 2 antibody, potassium voltage-gated channel, subfamily Q, member 2 antibody, potassium voltage-gated channel subfamily KQT member 2 antibody, potassium voltage-gated channel, KQT-like subfamily, member 2a antibody, KCNQ2 antibody, Kcnq2 antibody, LOC100537363 antibody, kcnq2a antibody
- Background
- The M channel is a slowly activating and deactivating potassium channel that plays a critical role in the regulation of neuronal excitability. The M channel is formed by the association of the protein encoded by the KCNQ2 gene and a related protein encoded by the KCNQ3 gene, both integral membrane proteins. M channel currents are inhibited by M1 muscarinic acetylcholine receptors and activated by retigabine, a novel anti-convulsant drug. Defects in KCNQ2 are a cause of benign familial neonatal convulsions type 1 (BFNC), also known as epilepsy, benign neonatal type 1 (EBN1).
- Molecular Weight
- 43 kDa (MW of target protein)
-