TRPM5 antibody (N-Term)

Catalog No. ABIN630115

Product Details anti-TRPM5 Antibody

Target: TRPM5 (Transient Receptor Potential Cation Channel, Subfamily M, Member 5 (TRPM5))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TRPM5 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: TRPM5 antibody was raised against the N terminal of TRPM5

Purification: Purified

Immunogen: TRPM5 antibody was raised using the N terminal of TRPM5 corresponding to a region with amino acids AAPWLILVGSGGIADVLAALVNQPHLLVPKVAEKQFKEKFPSKHFSWEDI

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TRPM5 Blocking Peptide, catalog no. 33R-1043, is also available for use as a blocking control in assays to test for specificity of this TRPM5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRPM5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TRPM5

Target: TRPM5 (Transient Receptor Potential Cation Channel, Subfamily M, Member 5 (TRPM5))

Alternative Name: TRPM5 (TRPM5 Products)

Synonyms: LTRPC5 antibody, MTR1 antibody, 9430099A16Rik antibody, LTrpC-5 antibody, Ltrpc5 antibody, Mtr1 antibody, transient receptor potential cation channel subfamily M member 5 antibody, transient receptor potential cation channel, subfamily M, member 5 antibody, TRPM5 antibody, Trpm5 antibody, trpm5 antibody

Background: TRPM5 is a voltage-modulated Ca(2+)-activated, monovalent cation channel (VCAM) that mediates a transient membrane depolarization and plays a central role in taste transduction. It is activated by arachidonic acid in vitro. It may be involved in perception of bitter, sweet and umami tastes. It may also be involved in sensing semiochemicals.

Molecular Weight: 131 kDa (MW of target protein)