SOD1 antibody (N-Term)

Catalog No. ABIN630121

Product Details anti-SOD1 Antibody

Target: SOD1 (Superoxide Dismutase 1, Soluble (SOD1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SOD1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: SOD1 antibody was raised against the N terminal of SOD1

Purification: Purified

Immunogen: SOD1 antibody was raised using the N terminal of SOD1 corresponding to a region with amino acids MATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHE

Application Details

Application Notes: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SOD1 Blocking Peptide, catalog no. 33R-5777, is also available for use as a blocking control in assays to test for specificity of this SOD1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SOD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SOD1

Target: SOD1 (Superoxide Dismutase 1, Soluble (SOD1))

Alternative Name: SOD1 (SOD1 Products)

Synonyms: LOC692639 antibody, ALS antibody, ALS1 antibody, IPOA antibody, SOD antibody, hSod1 antibody, homodimer antibody, CG11793 antibody, Cu antibody, Cu-Zn SOD antibody, Cu/Zn SOD antibody, Cu/Zn sod antibody, Cu/Zn superoxide dismutase antibody, Cu/ZnSOD antibody, CuSOD antibody, CuZn SOD antibody, CuZn-SOD antibody, CuZn-SOD1 antibody, CuZnSOD antibody, Cu[2+]/Zn[2+]SOD antibody, Dmel\\CG11793 antibody, G antibody, Mn SOD antibody, SOD-1 antibody, SOD1 antibody, Sod-1 antibody, Sod1 antibody, To antibody, To-1 antibody, Zn SOD antibody, Zn Sod antibody, Zn-SOD antibody, ZnSod antibody, cSOD antibody, cSod antibody, dSOD1 antibody, l(3)108 antibody, l(3)68Af' antibody, l(3)G antibody, sod antibody, sod1 antibody, CU/ZN-SOD antibody, SODC antibody, DKFZP469M1833 antibody, B430204E11Rik antibody, Cu/Zn-SOD antibody, Ipo-1 antibody, Ipo1 antibody, SOD1L1 antibody, XSODB antibody, als antibody, als1 antibody, ipoa antibody, sod1-a antibody, ZSOD antibody, cuzn antibody, Cu/Zn superoxide dismutase antibody, superoxide dismutase 1 antibody, Superoxide dismutase 1 antibody, superoxide dismutase 1, soluble antibody, superoxide dismutase 1 S homeolog antibody, Superoxide dismutase [Cu-Zn] antibody, superoxide dismutase 1 L homeolog antibody, superoxide dismutase [Cu-Zn]-like antibody, superoxide dismutase [Cu-Zn] antibody, superoxide dismutase Sod1 antibody, SOD antibody, SOD1 antibody, Sod1 antibody, sod1 antibody, sod1.S antibody, sod-1 antibody, sod1.L antibody, LOC101451855 antibody, LOC101115136 antibody

Background: SOD1 binds copper and zinc ions and is one of two isozymes responsible for destroying free superoxide radicals in the body. This isozyme is a soluble cytoplasmic protein, acting as a homodimer to convert naturally-occuring but harmful superoxide radicals to molecular oxygen and hydrogen peroxide. The other isozyme is a mitochondrial protein. Mutations in its gene have been implicated as causes of familial amyotrophic lateral sclerosis.

Molecular Weight: 16 kDa (MW of target protein)

Pathways: Sensory Perception of Sound, Transition Metal Ion Homeostasis