RED1 antibody

Catalog No. ABIN630123

Product Details anti-RED1 Antibody

Target: RED1 (ADARB1) (Adenosine Deaminase, RNA-Specific, B1 (ADARB1))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RED1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Purified

Immunogen: ADARB1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QLSNGGGGGPGRKRPLEEGSNGHSKYRLKKRRKTPGPVLPKNALMQLNEI

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ADARB1 Blocking Peptide, catalog no. 33R-7645, is also available for use as a blocking control in assays to test for specificity of this ADARB1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADARB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RED1

Target: RED1 (ADARB1) (Adenosine Deaminase, RNA-Specific, B1 (ADARB1))

Alternative Name: ADARB1 (ADARB1 Products)

Synonyms: ADARB1 antibody, RED1 antibody, ADAR2 antibody, DRABA2 antibody, DRADA2 antibody, 1700057H01Rik antibody, AW124433 antibody, AW558573 antibody, Adar2 antibody, BB220382 antibody, D10Bwg0447e antibody, Red1 antibody, adar2 antibody, adarb1 antibody, red1 antibody, adenosine deaminase, RNA specific B1 antibody, adenosine deaminase, RNA-specific, B1 antibody, adenosine deaminase, RNA-specific, B1 L homeolog antibody, adenosine deaminase, RNA-specific, B1a antibody, ADARB1 antibody, adarb1 antibody, adarb1.L antibody, Adarb1 antibody, adarb1a antibody

Background: ADARB1 is an enzyme responsible for pre-mRNA editing of the glutamate receptor subunit B by site-specific deamination of adenosines. Studies in rat found that this enzyme acted on its own pre-mRNA molecules to convert an AA dinucleotide to an AI dinucleotide which resulted in a new splice site.

Molecular Weight: 77 kDa (MW of target protein)