MMP1 antibody

Catalog No. ABIN630128

Product Details anti-MMP1 Antibody

Target: MMP1 (Matrix Metallopeptidase 1 (Interstitial Collagenase) (MMP1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MMP1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogen: MMP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PATLETQEQDVDLVQKYLEKYYNLKNDGRQVEKRRNSGPVVEKLKQMQEF

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MMP1 Blocking Peptide, catalog no. 33R-6984, is also available for use as a blocking control in assays to test for specificity of this MMP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MMP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MMP1

Target: MMP1 (Matrix Metallopeptidase 1 (Interstitial Collagenase) (MMP1))

Alternative Name: MMP1 (MMP1 Products)

Synonyms: CLG antibody, CLGN antibody, Mmp1a antibody, CG4859 antibody, Dm1-MMP antibody, Dmel\\CG4859 antibody, MMP-1 antibody, MMP1 antibody, Mmp 1 antibody, dMMP1 antibody, dm1-MMP antibody, dmmp1 antibody, l(2)k04809 antibody, mmp1 antibody, Mmp1 antibody, Mcol-A antibody, Mcola antibody, col4 antibody, mmp18 antibody, Clgn antibody, matrix metallopeptidase 1 antibody, Matrix metalloproteinase 1 antibody, matrix metalloproteinase 1 antibody, matrix metallopeptidase 1 (interstitial collagenase) antibody, matrix metallopeptidase 1a (interstitial collagenase) antibody, matrix metallopeptidase 1 S homeolog antibody, interstitial collagenase antibody, matrix metallopeptidase 8 L homeolog antibody, MMP1 antibody, Mmp1 antibody, RB11133 antibody, Mmp1a antibody, mmp1.S antibody, LOC100727966 antibody, mmp8.L antibody

Background: Proteins of the matrix metalloproteinase (MMP) family are involved in the Breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. MMP1 is a secreted enzyme which breaks down the interstitial collagens, types I, II, and III.

Molecular Weight: 52 kDa (MW of target protein)