Chromogranin A antibody

Catalog No. ABIN630138

Product Details anti-Chromogranin A Antibody

Target: Chromogranin A (CHGA)

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Chromogranin A antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Purified

Immunogen: Chromogranin A antibody was raised using a synthetic peptide corresponding to a region with amino acids PVSQECFETLRGDERILSILRHQNLLKELQDLALQGAKERAHQQKKHSGF

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Chromogranin A Blocking Peptide, catalog no. 33R-7425, is also available for use as a blocking control in assays to test for specificity of this Chromogranin A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHGA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Chromogranin A

Target: Chromogranin A (CHGA)

Alternative Name: Chromogranin A (CHGA Products)

Synonyms: CGA antibody, CG-ALPHA antibody, FSHA antibody, GPHA1 antibody, GPHa antibody, HCG antibody, LHA antibody, TSHA antibody, ChrA antibody, fj05f09 antibody, si:dkey-177p2.2 antibody, wu:fj05f09 antibody, zgc:101749 antibody, zgc:56075 antibody, CHGA antibody, cgA antibody, chga antibody, chromogranin A antibody, glycoprotein hormones, alpha polypeptide antibody, uncharacterized CHGA antibody, chromogranin A S homeolog antibody, CHGA antibody, CGA antibody, Chga antibody, chga antibody, chga.S antibody

Background: CHGA is a member of the chromogranin/secretogranin family of neuroendocrine secretory proteins. It is found in secretory vesicles of neurons and endocrine cells. Its gene product is a precursor to three biologically active peptides, vasostatin, pancreastatin, and parastatin. These peptides act as autocrine or paracrine negative modulators of the neuroendocrine system. Other peptides, including chromostatin, beta-granin, WE-14 and GE-25, are also derived from the full-length protein. However, biological activities for these molecules have not been shown.

Molecular Weight: 51 kDa (MW of target protein)

Pathways: Negative Regulation of Hormone Secretion, cAMP Metabolic Process, Regulation of G-Protein Coupled Receptor Protein Signaling