WNT9B antibody (C-Term)

Catalog No. ABIN630146

Product Details anti-WNT9B Antibody

Target: WNT9B (Wingless-Type MMTV Integration Site Family, Member 9B (WNT9B))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This WNT9B antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: WNT9 B antibody was raised against the C terminal of WNT9

Purification: Purified

Immunogen: WNT9 B antibody was raised using the C terminal of WNT9 corresponding to a region with amino acids FRETGQVLKLRYDSAVKVSSATNEALGRLELWAPARQGSLTKGLAPRSGD

Application Details

Application Notes: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

WNT9B Blocking Peptide, catalog no. 33R-3045, is also available for use as a blocking control in assays to test for specificity of this WNT9B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WNT0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for WNT9B

Target: WNT9B (Wingless-Type MMTV Integration Site Family, Member 9B (WNT9B))

Alternative Name: WNT9B (WNT9B Products)

Synonyms: WNT14B antibody, WNT15 antibody, WNT9B antibody, wnt-9b antibody, Wnt14b antibody, Wnt15 antibody, clf antibody, clf1 antibody, wnt-14b antibody, wnt-15 antibody, Wnt family member 9B antibody, wingless-type MMTV integration site family member 9B L homeolog antibody, protein Wnt-9b antibody, wingless-type MMTV integration site family, member 9B antibody, WNT9B antibody, wnt9b.2.L antibody, Wnt9b antibody, LOC468296 antibody, wnt9b antibody

Background: WNT9B is a member of the WNT family. They are secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis.

Molecular Weight: 39 kDa (MW of target protein)

Pathways: WNT Signaling, Tube Formation