PROC antibody
-
- Target See all PROC Antibodies
- PROC (Vitamin K-dependent protein C (PROC))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PROC antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Purified
- Immunogen
- Protein C antibody was raised using a synthetic peptide corresponding to a region with amino acids MWQLTSLLLFVATWGISGTPAPLDSVFSSSERAHQVLRIRKRANSFLEEL
- Top Product
- Discover our top product PROC Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Protein C Blocking Peptide, catalog no. 33R-6620, is also available for use as a blocking control in assays to test for specificity of this Protein C antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PROC antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PROC (Vitamin K-dependent protein C (PROC))
- Alternative Name
- Protein C (PROC Products)
- Synonyms
- proc antibody, si:ch1073-188c16.3 antibody, zgc:63987 antibody, PROC antibody, APC antibody, PC antibody, PROC1 antibody, THPH3 antibody, THPH4 antibody, proc1 antibody, MGC64425 antibody, PA antibody, protein C, inactivator of coagulation factors Va and VIIIa antibody, protein C (inactivator of coagulation factors Va and VIIIa), a antibody, protein C (inactivator of coagulation factors Va and VIIIa) antibody, protein C, inactivator of coagulation factors Va and VIIIa S homeolog antibody, vitamin K-dependent protein C antibody, prosaposin antibody, protein C antibody, proline rich protein HaeIII subfamily 1 antibody, PROC antibody, proca antibody, proc.S antibody, proc antibody, CpipJ_CPIJ000393 antibody, CpipJ_CPIJ002754 antibody, CpipJ_CPIJ003717 antibody, CpipJ_CPIJ003718 antibody, CpipJ_CPIJ014440 antibody, CpipJ_CPIJ018032 antibody, CpipJ_CPIJ018737 antibody, PSAP antibody, Proc antibody, PRH1 antibody
- Target Type
- Viral Protein
- Background
- Protein C is a vitamin K-dependent serine protease that regulates blood coagulation by inactivating factors Va and VIIIa in the presence of calcium ions and phospholipids.
- Molecular Weight
- 52 kDa (MW of target protein)
-