DVL1 antibody

Catalog No. ABIN630211

Product Details anti-DVL1 Antibody

Target: DVL1 (Dishevelled Segment Polarity Protein 1 (DVL1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DVL1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Purified

Immunogen: DVL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LKITIANAVIGADVVDWLYTHVEGFKERREARKYASSLLKHGFLRHTVNK

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DVL1 Blocking Peptide, catalog no. 33R-5088, is also available for use as a blocking control in assays to test for specificity of this DVL1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DVL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DVL1

Target: DVL1 (Dishevelled Segment Polarity Protein 1 (DVL1))

Alternative Name: DVL1 (DVL1 Products)

Synonyms: DVL antibody, DVL1L1 antibody, DVL1P1 antibody, Dvl antibody, mKIAA4029 antibody, dvl-1 antibody, DSH antibody, DVL-1 antibody, dvl1 antibody, dvl2l antibody, Xdsh antibody, dsh1 antibody, dishevelled segment polarity protein 1 antibody, dishevelled, dsh homolog 1 (Drosophila) antibody, microRNA 6808 antibody, dishevelled segment polarity protein 1b antibody, dishevelled segment polarity protein 1 L homeolog antibody, DVL1 antibody, Dvl1 antibody, MIR6808 antibody, dvl1b antibody, dvl1.L antibody

Background: DVL1 is a cytoplasmic phosphoprotein that regulates cell proliferation, acting as a transducer molecule for developmental processes, including segmentation and neuroblast specification. DVL1 gene is a candidate for neuroblastomatous transformation. The Schwartz-Jampel syndrome and Charcot-Marie-Tooth disease type 2A have been mapped to the same region as DVL1 gene. The phenotypes of these diseases may be consistent with defects which might be expected from aberrant expression of a DVL gene during development.

Molecular Weight: 38 kDa (MW of target protein)

Pathways: WNT Signaling, Synaptic Membrane, Skeletal Muscle Fiber Development