NSMCE1 antibody

Catalog No. ABIN630218

Product Details anti-NSMCE1 Antibody

Target: NSMCE1 (Non-SMC Element 1 Homolog (NSMCE1))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NSMCE1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Purified

Immunogen: NSMCE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RPIYALVNLATTSISKMATDFAENELDLFRKALELIIDSETGFASSTNIL

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NSMCE1 Blocking Peptide, catalog no. 33R-8094, is also available for use as a blocking control in assays to test for specificity of this NSMCE1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NSMCE1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NSMCE1

Target: NSMCE1 (Non-SMC Element 1 Homolog (NSMCE1))

Alternative Name: NSMCE1 (NSMCE1 Products)

Synonyms: zgc:92777 antibody, NSMCE1 antibody, NSE1 antibody, 2510027N19Rik antibody, RGD1307760 antibody, NSE1 homolog, SMC5-SMC6 complex component antibody, NSE1 homolog, SMC5-SMC6 complex component L homeolog antibody, nsmce1 antibody, NSMCE1 antibody, nsmce1.L antibody, Nsmce1 antibody

Background: NSMCE1 is a probable component of the SMC5-SMC6 complex, a complex involved in DNA double-strand breaks by homologous recombination. The complex may promote sister chromatid homologous recombination by recruiting the SMC1-SMC3 cohesin complex to double-strand breaks.

Molecular Weight: 28 kDa (MW of target protein)

Pathways: Positive Regulation of Response to DNA Damage Stimulus