GJB2 antibody (N-Term)

Catalog No. ABIN630258

Product Details anti-GJB2 Antibody

Target: GJB2 (Gap Junction Protein, beta 2, 26kDa (GJB2))

Binding Specificity: N-Term

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GJB2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GJB2 antibody was raised against the N terminal of GJB2

Purification: Purified

Immunogen: GJB2 antibody was raised using the N terminal of GJB2 corresponding to a region with amino acids STPALLVAMHVAYRRHEKKRKFIKGEIKSEFKDIEEIKTQKVRIEGSLWW

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GJB2 Blocking Peptide, catalog no. 33R-8880, is also available for use as a blocking control in assays to test for specificity of this GJB2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GJB2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GJB2

Target: GJB2 (Gap Junction Protein, beta 2, 26kDa (GJB2))

Alternative Name: GJB2 (GJB2 Products)

Synonyms: ppk antibody, cx26 antibody, dfna3 antibody, dfnb1 antibody, nsrd1 antibody, dfna3a antibody, dfnb1a antibody, MGC53062 antibody, connexin-26 antibody, GJB2 antibody, AI325222 antibody, Cnx26 antibody, Cx26 antibody, Gjb-2 antibody, CXN-26 antibody, CX26 antibody, DFNA3 antibody, DFNA3A antibody, DFNB1 antibody, DFNB1A antibody, HID antibody, KID antibody, NSRD1 antibody, PPK antibody, gap junction protein beta 2 L homeolog antibody, gap junction protein beta 2 antibody, gap junction protein, beta 2 antibody, gjb2.L antibody, GJB2 antibody, Gjb2 antibody

Background: Gap junctions were first characterized by electron microscopy as regionally specialized structures on plasma membranes of contacting adherent cells. These structures were shown to consist of cell-to-cell channels. Proteins, called connexins, purified from fractions of enriched gap junctions from different tissues differ. The connexins are designated by their molecular mass. Another system of nomenclature divides gap junction proteins into 2 categories, alpha and beta, according to sequence similarities at the nucleotide and amino acid levels. For example, CX43 is designated alpha-1 gap junction protein, whereas CX32 and CX26 are called beta-1 and beta-2 gap junction proteins, respectively. This nomenclature emphasizes that CX32 and CX26 are more homologous to each other than either of them is to CX43.

Molecular Weight: 25 kDa (MW of target protein)

Pathways: Sensory Perception of Sound, Cell-Cell Junction Organization