GJB4 antibody (Middle Region)

Catalog No. ABIN630263

Product Details anti-GJB4 Antibody

Target: GJB4 (Gap Junction Protein, beta 4, 30.3kDa (GJB4))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GJB4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GJB4 antibody was raised against the middle region of GJB4

Purification: Purified

Immunogen: GJB4 antibody was raised using the middle region of GJB4 corresponding to a region with amino acids CPSLLVVMHVAYREERERKHHLKHGPNAPSLYDNLSKKRGGLWWTYLLSL

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GJB4 Blocking Peptide, catalog no. 33R-1774, is also available for use as a blocking control in assays to test for specificity of this GJB4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GJB4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GJB4

Target: GJB4 (Gap Junction Protein, beta 4, 30.3kDa (GJB4))

Alternative Name: GJB4 (GJB4 Products)

Synonyms: GJB4 antibody, Cnx30.3 antibody, Cx30.3 antibody, Gjb-4 antibody, CX30.3 antibody, EKV antibody, gap junction protein beta 4 antibody, gap junction protein, beta 4 antibody, GJB4 antibody, Gjb4 antibody

Background: Connexins are homologous four-transmembrane-domain proteins and major components of gap junctions. The GJB4 gene encodes connexin 30.3 (Cx30.3) A mutation in connexin 30.3 is causally involved in erythrokeratodermia variabilis (EKV), a mostly autosomal dominant disorder of keratinization.

Molecular Weight: 29 kDa (MW of target protein)