C-Type Lectin Domain Family 4, Member M (CLEC4M) (N-Term) antibody

Catalog No. ABIN630277

Product Details

Target: C-Type Lectin Domain Family 4, Member M (CLEC4M)

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: Un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: CLEC4 M antibody was raised against the N terminal of CLEC4

Purification: Purified

Immunogen: CLEC4 M antibody was raised using the N terminal of CLEC4 corresponding to a region with amino acids LVLQLLSFMLLAGVLVAILVQVSKVPSSLSQEQSEQDAIYQNLTQLKAAV

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CLEC4M Blocking Peptide, catalog no. 33R-5525, is also available for use as a blocking control in assays to test for specificity of this CLEC4M antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLEC0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details

Target: C-Type Lectin Domain Family 4, Member M (CLEC4M)

Alternative Name: CLEC4M (CLEC4M Products)

Synonyms: CD209L antibody, CD299 antibody, DC-SIGN2 antibody, DC-SIGNR antibody, DCSIGNR antibody, HP10347 antibody, L-SIGN antibody, LSIGN antibody, CD209B antibody, C-type lectin domain family 4 member M antibody, CLEC4M antibody

Background: CLEC4M is a type II integral membrane protein that is 77% identical to CD209 antigen, a HIV gp120-binding protein. This protein, like CD209, efficiently binds both intercellular adhesion molecule 3 (ICAM3) and HIV-1 gp120, and enhances HIV-1 infection of T cells.

Molecular Weight: 44 kDa (MW of target protein)