SLC35C1 antibody (N-Term)

Catalog No. ABIN630296

Product Details anti-SLC35C1 Antibody

Target: SLC35C1 (Solute Carrier Family 35, Member C1 (SLC35C1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC35C1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SLC35 C1 antibody was raised against the N terminal of SLC35 1

Purification: Purified

Immunogen: SLC35 C1 antibody was raised using the N terminal of SLC35 1 corresponding to a region with amino acids TSISMVFLNKYLLDSPSLRLDTPIFVTFYQCLVTTLLCKGLSALAACCPG

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC35C1 Blocking Peptide, catalog no. 33R-9287, is also available for use as a blocking control in assays to test for specificity of this SLC35C1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC35C1

Target: SLC35C1 (Solute Carrier Family 35, Member C1 (SLC35C1))

Alternative Name: SLC35C1 (SLC35C1 Products)

Synonyms: CDG2C antibody, FUCT1 antibody, E430007K15Rik antibody, fuct1 antibody, GDP-Fuc-Tr antibody, SLC35C1 antibody, wu:fc03b12 antibody, zgc:101867 antibody, solute carrier family 35 member C1 antibody, GDP-fucose transporter 1 antibody, hypothetical protein antibody, solute carrier family 35, member C1 antibody, solute carrier family 35 (GDP-fucose transporter), member C1 antibody, SLC35C1 antibody, Chro.40354 antibody, PGTG_17642 antibody, Tsp_08269 antibody, Slc35c1 antibody, slc35c1 antibody

Background: SLC35C1 is involved in GDP-fucose import from the cytoplasm into the Golgi lumen.

Molecular Weight: 40 kDa (MW of target protein)