SLC25A16 antibody (N-Term)
-
- Target See all SLC25A16 Antibodies
- SLC25A16 (Solute Carrier Family 25 (Mitochondrial Carrier, Graves Disease Autoantigen), Member 16 (SLC25A16))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC25A16 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SLC25 A16 antibody was raised against the N terminal of SLC25 16
- Purification
- Purified
- Immunogen
- SLC25 A16 antibody was raised using the N terminal of SLC25 16 corresponding to a region with amino acids KTTVAPLDRVKVLLQAHNHHYKHLGVFSALRAVPQKEGFLGLYKGNGAMM
- Top Product
- Discover our top product SLC25A16 Primary Antibody
-
-
- Application Notes
-
WB: 5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC25A16 Blocking Peptide, catalog no. 33R-4697, is also available for use as a blocking control in assays to test for specificity of this SLC25A16 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 16 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC25A16 (Solute Carrier Family 25 (Mitochondrial Carrier, Graves Disease Autoantigen), Member 16 (SLC25A16))
- Alternative Name
- SLC25A16 (SLC25A16 Products)
- Synonyms
- gda antibody, gdc antibody, ml7 antibody, hml7 antibody, hgt.1 antibody, d10s105e antibody, 3110021G18Rik antibody, GDA antibody, GDC antibody, HGT.1 antibody, ML7 antibody, D10S105E antibody, hML7 antibody, wu:fc33c08 antibody, zgc:56187 antibody, zgc:77742 antibody, solute carrier family 25 member 16 antibody, solute carrier family 25 (mitochondrial carrier, Graves disease autoantigen), member 16 antibody, solute carrier family 25 (mitochondrial carrier; Graves disease autoantigen), member 16 antibody, SLC25A16 antibody, slc25a16 antibody, Slc25a16 antibody
- Background
- SLC25A16 is a protein that contains three tandemly repeated mitochondrial carrier protein domains. The protein is localized in the inner membrane and facilitates the rapid transport and exchange of molecules between the cytosol and the mitochondrial matrix space. SLC25A16 gene has a possible role in Graves' disease.
- Molecular Weight
- 36 kDa (MW of target protein)
-