TMEM91 antibody (N-Term)

Catalog No. ABIN630330

Product Details anti-TMEM91 Antibody

Target: TMEM91 (Transmembrane Protein 91 (TMEM91))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMEM91 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TMEM91 antibody was raised against the N terminal of TMEM91

Purification: Purified

Immunogen: TMEM91 antibody was raised using the N terminal of TMEM91 corresponding to a region with amino acids SPPLPSVSAGLGEPRPPDVEDMSSSDSDSDWDGGSRLSPFLPHDHLGLAV

Application Details

Application Notes: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMEM91 Blocking Peptide, catalog no. 33R-8688, is also available for use as a blocking control in assays to test for specificity of this TMEM91 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM91 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMEM91

Target: TMEM91 (Transmembrane Protein 91 (TMEM91))

Alternative Name: TMEM91 (TMEM91 Products)

Synonyms: DSPC3 antibody, IFITMD6 antibody, A830041P22Rik antibody, transmembrane protein 91 antibody, TMEM91 antibody, Tmem91 antibody

Background: The function of TMEM91 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 15 kDa (MW of target protein)