Corin antibody (C-Term)

Catalog No. ABIN630332

Product Details anti-Corin Antibody

Target: Corin (CORIN) (Corin, Serine Peptidase (CORIN))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Corin antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CORIN antibody was raised against the C terminal of CORIN

Purification: Purified

Immunogen: CORIN antibody was raised using the C terminal of CORIN corresponding to a region with amino acids HPRYSRAVVDYDISIVELSEDISETGYVRPVCLPNPEQWLEPDTYCYITG

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CORIN Blocking Peptide, catalog no. 33R-3817, is also available for use as a blocking control in assays to test for specificity of this CORIN antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CORIN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Corin

Target: Corin (CORIN) (Corin, Serine Peptidase (CORIN))

Alternative Name: CORIN (CORIN Products)

Synonyms: CORIN antibody, CG2105 antibody, Dmel\\CG2105 antibody, SP75 antibody, LOC559109 antibody, AV273130 antibody, Lrp4 antibody, ATC2 antibody, CRN antibody, PEE5 antibody, TMPRSS10 antibody, corin, serine peptidase antibody, CG2105 gene product from transcript CG2105-RC antibody, novel protein similar to H.sapiens CORIN, corin, serine peptidase (CORIN) antibody, corin antibody, CORIN antibody, Corin antibody, LOC559109 antibody

Background: CORIN is a member of the type II transmembrane serine protease class of the trypsin superfamily. Members of this family are composed of multiple structurally distinct domains. CORIN converts pro-atrial natriuretic peptide to biologically active atrial natriuretic peptide, a cardiac hormone that regulates blood volume and pressure. This protein may also function as a pro-brain-type natriuretic peptide convertase.

Molecular Weight: 74 kDa (MW of target protein)

Pathways: Regulation of Systemic Arterial Blood Pressure by Hormones