SLC26A8 antibody (C-Term)
-
- Target See all SLC26A8 Antibodies
- SLC26A8 (Solute Carrier Family 26 (Sulfate Transporter), Member 8 (SLC26A8))
-
Binding Specificity
- C-Term
- Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC26A8 antibody is un-conjugated
-
Application
- Immunohistochemistry (IHC), Western Blotting (WB)
- Specificity
- SLC26 A8 antibody was raised against the C terminal of SLC26 8
- Purification
- Purified
- Immunogen
- SLC26 A8 antibody was raised using the C terminal of SLC26 8 corresponding to a region with amino acids EPQPETEPEMEPNPKSRPRAHTFPQQRYWPMYHPSMASTQSQTQTRTWSV
- Top Product
- Discover our top product SLC26A8 Primary Antibody
-
-
- Application Notes
-
WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC26A8 Blocking Peptide, catalog no. 33R-2643, is also available for use as a blocking control in assays to test for specificity of this SLC26A8 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 8 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC26A8 (Solute Carrier Family 26 (Sulfate Transporter), Member 8 (SLC26A8))
- Alternative Name
- SLC26A8 (SLC26A8 Products)
- Synonyms
- SPGF3 antibody, TAT1 antibody, SLC26A8 antibody, MCT10 antibody, PRO0813 antibody, solute carrier family 26 member 8 antibody, solute carrier family 26, member 8 antibody, solute carrier family 16 member 10 antibody, SLC26A8 antibody, Slc26a8 antibody, SLC16A10 antibody
- Background
- SLC26A8 is one member of a family of sulfate/anion transporters. Family members are well conserved in their protein (aa length among species) structures yet have markedly different tissue expression patterns.
- Molecular Weight
- 61 kDa (MW of target protein)
- Pathways
- Dicarboxylic Acid Transport
-