SLC10A5 antibody

Catalog No. ABIN630340

Product Details anti-SLC10A5 Antibody

Target: SLC10A5 (Solute Carrier Family 10 (Sodium/bile Acid Cotransporter Family), Member 5 (SLC10A5))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC10A5 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogen: SLC10 A5 antibody was raised using a synthetic peptide corresponding to a region with amino acids GYSFAKVCTLPLPVCKTVAIESGMLNSFLALAVIQLSFPQSKANLASVAP

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC10A5 Blocking Peptide, catalog no. 33R-3684, is also available for use as a blocking control in assays to test for specificity of this SLC10A5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC10A5

Target: SLC10A5 (Solute Carrier Family 10 (Sodium/bile Acid Cotransporter Family), Member 5 (SLC10A5))

Alternative Name: SLC10A5 (SLC10A5 Products)

Synonyms: SLC10A5 antibody, Gm405 antibody, mP5 antibody, P5 antibody, solute carrier family 10 member 5 antibody, solute carrier family 10 (sodium/bile acid cotransporter family), member 5 antibody, sodium/bile acid cotransporter 5 antibody, solute carrier family 10, member 5 antibody, SLC10A5 antibody, LOC100456732 antibody, Slc10a5 antibody

Background: SLC10A5 is a new member of Solute Carrier Family 10 (SLC10) and the function remains unknown.

Molecular Weight: 48 kDa (MW of target protein)