SLC2A6 antibody (Solute Carrier Family 2 (Facilitated Glucose Transporter), Member 6)

Details for Product anti-SLC2A6 Antibody No. ABIN630369
Antigen
  • A330096C23
  • F630103L12Rik
  • Glut6
  • Glut9
  • glut6
  • glut9
  • MGC82056
  • SLC2A6
  • si:dkey-104n9.2
  • GLUT6
  • GLUT9
  • HSA011372
  • solute carrier family 2 (facilitated glucose transporter), member 6
  • solute carrier family 2 member 6
  • solute carrier family 2 (facilitated glucose transporter), member 6 L homeolog
  • Slc2a6
  • SLC2A6
  • slc2a6.L
  • slc2a6
Reactivity
Human
22
2
1
1
1
Host
Rabbit
20
2
Clonality
Polyclonal
Conjugate
This SLC2A6 antibody is un-conjugated
1
1
1
1
1
1
1
Application
Immunohistochemistry (IHC), Western Blotting (WB)
17
8
7
1
1
1
Options
Immunogen GLUT6 antibody was raised using a synthetic peptide corresponding to a region with amino acids AANLTLGLYIHFGPRPLSPNSTAGLESESWGDLAQPLAAPAGYLTLVPLL
Purification Purified
Plasmids, Primers & others Plasmids, Primers & others SLC2A6 products on genomics-online (e.g. as negative or positive controls)
Antigen
Alternative Name GLUT6 (SLC2A6 Antibody Abstract)
Background Hexose transport into mammalian cells is catalyzed by a family of membrane proteins, including SLC2A6, which contains 12 transmembrane domains and a number of critical conserved residues.Hexose transport into mammalian cells is catalyzed by a family of membrane proteins, including SLC2A6, that contain 12 transmembrane domains and a number of critical conserved residues.
Molecular Weight 56 kDa (MW of target protein)
Application Notes WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.
Comment

GLUT6 Blocking Peptide, catalog no. 33R-1039, is also available for use as a blocking control in assays to test for specificity of this GLUT6 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 6 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Image no. 1 for anti-Solute Carrier Family 2 (Facilitated Glucose Transporter), Member 6 (SLC2A6) antibody (ABIN630369) GLUT6 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to s...
Image no. 2 for anti-Solute Carrier Family 2 (Facilitated Glucose Transporter), Member 6 (SLC2A6) antibody (ABIN630369) GLUT6 antibody used at 2.5 ug/ml to detect target protein.
Did you look for something else?