SLC35F5 antibody (C-Term)

Catalog No. ABIN630371

Product Details anti-SLC35F5 Antibody

Target: SLC35F5 (Solute Carrier Family 35, Member F5 (SLC35F5))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC35F5 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SLC35 F5 antibody was raised against the C terminal of SLC35 5

Purification: Purified

Immunogen: SLC35 F5 antibody was raised using the C terminal of SLC35 5 corresponding to a region with amino acids VDREDKLDIPMFFGFVGLFNLLLLWPGFFLLHYTGFEDFEFPNKVVLMCI

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC35F5 Blocking Peptide, catalog no. 33R-9476, is also available for use as a blocking control in assays to test for specificity of this SLC35F5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC35F5

Target: SLC35F5 (Solute Carrier Family 35, Member F5 (SLC35F5))

Alternative Name: SLC35F5 (SLC35F5 Products)

Synonyms: 1300003P13Rik antibody, AI646727 antibody, solute carrier family 35 member F5 antibody, solute carrier family 35, member F5 antibody, SLC35F5 antibody, Slc35f5 antibody

Background: SLC35F5 is a putative solute transporter.

Molecular Weight: 59 kDa (MW of target protein)