SLCO6A1 antibody (C-Term)
-
- Target See all SLCO6A1 Antibodies
- SLCO6A1 (Solute Carrier Organic Anion Transporter Family, Member 6A1 (SLCO6A1))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLCO6A1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SLCO6 A1 antibody was raised against the C terminal of SLCO6 1
- Purification
- Purified
- Immunogen
- SLCO6 A1 antibody was raised using the C terminal of SLCO6 1 corresponding to a region with amino acids LAMTRVVPDKLRSLALGVSYVILRIFGTIPGPSIFKMSGETSCILRDVNK
- Top Product
- Discover our top product SLCO6A1 Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLCO6A1 Blocking Peptide, catalog no. 33R-4785, is also available for use as a blocking control in assays to test for specificity of this SLCO6A1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLCO0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLCO6A1 (Solute Carrier Organic Anion Transporter Family, Member 6A1 (SLCO6A1))
- Alternative Name
- SLCO6A1 (SLCO6A1 Products)
- Synonyms
- CT48 antibody, GST antibody, OATP6A1 antibody, OATPY antibody, SLCO6A1 antibody, solute carrier organic anion transporter family member 6A1 antibody, SLCO6A1 antibody
- Background
- SLCO6A1 is involved in transporter activity (solute carrier).
- Molecular Weight
- 79 kDa (MW of target protein)
-