NAT2 antibody
-
- Target See all NAT2 Antibodies
- NAT2 (N-Acetyltransferase 2 (Arylamine N-Acetyltransferase) (NAT2))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NAT2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Purified
- Immunogen
- NAT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids CLTEERGIWYLDQIRREQYITNKEFLNSHLLPKKKHQKIYLFTLEPRTIE
- Top Product
- Discover our top product NAT2 Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
NAT2 Blocking Peptide, catalog no. 33R-1747, is also available for use as a blocking control in assays to test for specificity of this NAT2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NAT2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NAT2 (N-Acetyltransferase 2 (Arylamine N-Acetyltransferase) (NAT2))
- Alternative Name
- NAT2 (NAT2 Products)
- Synonyms
- AAC2 antibody, NAT-2 antibody, PNAT antibody, AV377607 antibody, Nat2a antibody, NAT antibody, AT-2 antibody, AT-B/AT-II antibody, AT-II antibody, AT2 antibody, N-acetyltransferase 2 antibody, N-acetyltransferase 2 (arylamine N-acetyltransferase) antibody, NAT2 antibody, Nat2 antibody
- Background
- NAT2 is a N-acetyltransferase 2 (arylamine N-acetyltransferase 2). This enzyme functions to both activate and deactivate arylamine and hydrazine drugs and carcinogens. Polymorphisms in its gene are reponsible for the N-acetylation polymorphism in which human populations segregate into rapid,intermediate, and slow acetylator phenotypes. Polymorphisms in NAT2 are also associated with higher incidences of cancer and drug toxicity.
- Molecular Weight
- 32 kDa (MW of target protein)
-