SMPD2 antibody
-
- Target See all SMPD2 Antibodies
- SMPD2 (Sphingomyelin phosphodiesterase 2, Neutral Membrane (Neutral Sphingomyelinase) (SMPD2))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SMPD2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Purified
- Immunogen
- SMPD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids RQKLSPTYPAAHHFRSGIIGSGLCVFSKHPIQELTQHIYTLNGYPYMIHH
- Top Product
- Discover our top product SMPD2 Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SMPD2 Blocking Peptide, catalog no. 33R-8123, is also available for use as a blocking control in assays to test for specificity of this SMPD2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SMPD2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SMPD2 (Sphingomyelin phosphodiesterase 2, Neutral Membrane (Neutral Sphingomyelinase) (SMPD2))
- Alternative Name
- SMPD2 (SMPD2 Products)
- Synonyms
- SMPD2 antibody, NSMase antibody, isc1 antibody, nsmase antibody, nsmase1 antibody, AW108287 antibody, nSMase antibody, nSMase1 antibody, ISC1 antibody, NSMASE antibody, NSMASE1 antibody, sphingomyelin phosphodiesterase 2 antibody, sphingomyelin phosphodiesterase 2a, neutral membrane (neutral sphingomyelinase) antibody, sphingomyelin phosphodiesterase 2, neutral membrane (neutral sphingomyelinase) antibody, sphingomyelin phosphodiesterase 2, neutral antibody, SMPD2 antibody, smpd2a antibody, smpd2 antibody, Smpd2 antibody
- Background
- SMPD2 converts sphingomyelin to ceramide. Hydrolyze 1-acyl-2-lyso-sn-glycero-3-phosphocholine (lyso-PC) and 1-O-alkyl-2-lyso-sn-glycero-3-phosphocholine (lyso-platelet-activating factor). The physiological substrate seems to be Lyso-PAF.
- Molecular Weight
- 48 kDa (MW of target protein)
- Pathways
- Neurotrophin Signaling Pathway
-