LAPTM4A antibody (Middle Region)

Catalog No. ABIN630387

Product Details anti-LAPTM4A Antibody

Target: LAPTM4A (Lysosomal Protein Transmembrane 4 alpha (LAPTM4A))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LAPTM4A antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: LAPTM4 A antibody was raised against the middle region of LAPTM4

Purification: Purified

Immunogen: LAPTM4 A antibody was raised using the middle region of LAPTM4 corresponding to a region with amino acids VLSCLVAISSLTYLPRIKEYLDQLPDFPYKDDLLALDSSCLLFIVLVFFA

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LAPTM4A Blocking Peptide, catalog no. 33R-9682, is also available for use as a blocking control in assays to test for specificity of this LAPTM4A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LAPTM0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LAPTM4A

Target: LAPTM4A (Lysosomal Protein Transmembrane 4 alpha (LAPTM4A))

Alternative Name: LAPTM4A (LAPTM4A Products)

Synonyms: HUMORF13 antibody, LAPTM4 antibody, MBNT antibody, Mtrp antibody, wu:fb57c07 antibody, wu:fj99e08 antibody, laptm4 antibody, laptm4a antibody, laptm4aa antibody, mbnt antibody, mtrp antibody, AA286466 antibody, MTP antibody, mKIAA0108 antibody, lysosomal protein transmembrane 4 alpha antibody, lysosomal-associated protein transmembrane 4 alpha L homeolog antibody, lysosomal-associated protein transmembrane 4A antibody, LAPTM4A antibody, Laptm4a antibody, laptm4a antibody, laptm4a.L antibody

Background: LAPTM4A is a protein that has four predicted transmembrane domains. The function of its gene has not yet been determined, however, studies in the mouse homolog suggest a role in the transport of small molecules across endosomal and lysosomal membranes.

Molecular Weight: 27 kDa (MW of target protein)