MAS1 antibody (Middle Region)

Catalog No. ABIN630411

Product Details anti-MAS1 Antibody

Target: MAS1 (MAS1 Oncogene (MAS1))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MAS1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: MAS1 antibody was raised against the middle region of MAS1

Purification: Purified

Immunogen: MAS1 antibody was raised using the middle region of MAS1 corresponding to a region with amino acids RPKYQSALVCALLWALSCLVTTMEYVMCIDREEESHSRNDCRAVIIFIAI

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MAS1 Blocking Peptide, catalog no. 33R-8095, is also available for use as a blocking control in assays to test for specificity of this MAS1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MAS1

Target: MAS1 (MAS1 Oncogene (MAS1))

Alternative Name: MAS1 (MAS1 Products)

Synonyms: MAS antibody, Mas-1 antibody, c-mas antibody, MAS1 antibody, MAS1 proto-oncogene, G protein-coupled receptor antibody, MAS1 oncogene antibody, proto-oncogene Mas antibody, MAS1 antibody, Mas1 antibody, LOC703105 antibody

Background: The structure of MAS1 indicates that it belongs to the class of receptors that are coupled to GTP-binding proteins and share a conserved structural motif, which is described as a '7-transmembrane segment' following the prediction that these hydrophobic segments form membrane-spanning alpha-helices. The MAS1 protein may be a receptor that, when activated, modulates a critical component in a growth-regulating pathway to bring about oncogenic effects.

Molecular Weight: 37 kDa (MW of target protein)

Pathways: ACE Inhibitor Pathway, Regulation of Carbohydrate Metabolic Process