LTC4S antibody (N-Term)

Catalog No. ABIN630425

Product Details anti-LTC4S Antibody

Target: LTC4S (Leukotriene C4 Synthase (LTC4S))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LTC4S antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: LTC4 S antibody was raised against the N terminal of LTC4

Purification: Purified

Immunogen: LTC4 S antibody was raised using the N terminal of LTC4 corresponding to a region with amino acids MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVY

Application Details

Application Notes: WB: 1-2.5 µg/mL
Optimal conditions should be determined by the investigator.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LTC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LTC4S

Target: LTC4S (Leukotriene C4 Synthase (LTC4S))

Alternative Name: LTC4S (LTC4S Products)

Synonyms: LTC4S antibody, ltc4s antibody, si:dkey-33h4.2 antibody, leukotriene C4 synthase antibody, leukotriene C4 synthase-like antibody, leukotriene C4 synthase, gene 1 antibody, Ltc4s antibody, LTC4S antibody, LTC4SL antibody, ltc4s.1 antibody, ltc4s antibody

Background: The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family includes a number of human proteins, several of which are involved the production of leukotrienes. LTC4S is an enzyme that catalyzes the first step in the biosynthesis of cysteinyl leukotrienes, potent biological compounds derived from arachidonic acid. Leukotrienes have been implicated as mediators of anaphylaxis and inflammatory conditions such as human bronchial asthma.

Molecular Weight: 16 kDa (MW of target protein)

Pathways: Cellular Response to Molecule of Bacterial Origin