CYP3A7 antibody (Middle Region)

Catalog No. ABIN630440

Product Details anti-CYP3A7 Antibody

Target: CYP3A7 (Cytochrome P450, Family 3, Subfamily A, Polypeptide 7 (CYP3A7))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CYP3A7 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CYP3 A7 antibody was raised against the middle region of CYP3 7

Purification: Purified

Immunogen: CYP3 A7 antibody was raised using the middle region of CYP3 7 corresponding to a region with amino acids KSVKQIKEGRLKETQKHRVDFLQLMIDSQNSKDSETHKALSDLELMAQSI

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CYP3A7 Blocking Peptide, catalog no. 33R-4668, is also available for use as a blocking control in assays to test for specificity of this CYP3A7 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP0 7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CYP3A7

Target: CYP3A7 (Cytochrome P450, Family 3, Subfamily A, Polypeptide 7 (CYP3A7))

Alternative Name: CYP3A7 (CYP3A7 Products)

Synonyms: CP37 antibody, CYPIIIA7 antibody, P450-HFLA antibody, cytochrome P450, family 3, subfamily A, polypeptide 7 antibody, cytochrome P450 family 3 subfamily A member 7 antibody, CYP3A7 antibody

Background: CYP3A7 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This enzyme hydroxylates testosterone and dehydroepiandrosterone 3-sulphate, which is involved in the formation of estriol during pregnancy. The enzyme also metabolizes some drugs such as aflatoxin B1.

Molecular Weight: 57 kDa (MW of target protein)

Pathways: Steroid Hormone Biosynthesis