SLC22A11 antibody
-
- Target See all SLC22A11 Antibodies
- SLC22A11 (Solute Carrier Family 22 (Organic Cation Transporter), Member 11 (SLC22A11))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC22A11 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Purified
- Immunogen
- SLC22 A11 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAFSKLLEQAGGVGLFQTLQVLTFILPCLMIPSQMLLENFSAAIPGHRCW
- Top Product
- Discover our top product SLC22A11 Primary Antibody
-
-
- Application Notes
-
WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SLC22A11 Blocking Peptide, catalog no. 33R-5653, is also available for use as a blocking control in assays to test for specificity of this SLC22A11 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 11 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC22A11 (Solute Carrier Family 22 (Organic Cation Transporter), Member 11 (SLC22A11))
- Alternative Name
- SLC22A11 (SLC22A11 Products)
- Synonyms
- DKFZp469L1732 antibody, OAT4 antibody, hOAT4 antibody, solute carrier family 22 member 11 antibody, solute carrier family 22 member 24 antibody, SLC22A11 antibody, LOC100349650 antibody
- Background
- SLC22A11 is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. SLC22A11 is an integral membrane protein and is found mainly in the kidney and in the placenta, where it may act to prevent potentially harmful organic anions from reaching the fetus.
- Molecular Weight
- 60 kDa (MW of target protein)
-