NR1D1 antibody (Middle Region)
-
- Target See all NR1D1 Antibodies
- NR1D1 (Nuclear Receptor Subfamily 1, Group D, Member 1 (NR1D1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NR1D1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- NR1 D1 antibody was raised against the middle region of NR1 1
- Purification
- Affinity purified
- Immunogen
- NR1 D1 antibody was raised using the middle region of NR1 1 corresponding to a region with amino acids SQVARAHREIFTYAHDKLGSSPGNFNANHASGSPPATTPHRWENQGCPPA
- Top Product
- Discover our top product NR1D1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
NR1D1 Blocking Peptide, catalog no. 33R-8729, is also available for use as a blocking control in assays to test for specificity of this NR1D1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NR0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NR1D1 (Nuclear Receptor Subfamily 1, Group D, Member 1 (NR1D1))
- Alternative Name
- NR1D1 (NR1D1 Products)
- Synonyms
- MGC82865 antibody, MGC82881 antibody, Eip75B antibody, EAR1 antibody, THRA1 antibody, THRAL antibody, ear-1 antibody, hRev antibody, A530070C09Rik antibody, R75201 antibody, REV-ERBAALPHA antibody, nuclear receptor subfamily 1 group D member 1 L homeolog antibody, nuclear receptor subfamily 1, group d, member 1 antibody, nuclear receptor subfamily 1 group D member 1 antibody, nuclear receptor subfamily 1, group D, member 1 antibody, nr1d1.L antibody, nr1d1 antibody, NR1D1 antibody, Nr1d1 antibody
- Background
- NR1D1 belongs to the nuclear hormone receptor family, NR1 subfamily. It contains 1 nuclear receptor DNA-binding domain. NR1D1 functions as a constitutive transcriptional repressor. It is a possible receptor for triiodothyronine.
- Molecular Weight
- 67 kDa (MW of target protein)
- Pathways
- Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway, Cellular Response to Molecule of Bacterial Origin, Regulation of Lipid Metabolism by PPARalpha
-