NR0B2 antibody (N-Term)
-
- Target See all NR0B2 Antibodies
- NR0B2 (Nuclear Receptor Subfamily 0, Group B, Member 2 (NR0B2))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NR0B2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- NR0 B2 antibody was raised against the N terminal of NR0 2
- Purification
- Affinity purified
- Immunogen
- NR0 B2 antibody was raised using the N terminal of NR0 2 corresponding to a region with amino acids STSQPGACPCQGAASRPAILYALLSSSLKAVPRPRSRCLCRQHRPVQLCA
- Top Product
- Discover our top product NR0B2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
NR0B2 Blocking Peptide, catalog no. 33R-8889, is also available for use as a blocking control in assays to test for specificity of this NR0B2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NR0 2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NR0B2 (Nuclear Receptor Subfamily 0, Group B, Member 2 (NR0B2))
- Alternative Name
- NR0B2 (NR0B2 Products)
- Synonyms
- SHP antibody, SHP1 antibody, SHP-1 antibody, Shp1 antibody, Shp antibody, NR0B2-A antibody, Nr0b2 antibody, SHP-A antibody, gb:bc058069 antibody, nuclear receptor subfamily 0 group B member 2 antibody, nuclear receptor subfamily 0, group B, member 2 antibody, nuclear receptor subfamily 0, group B, member 2a antibody, NR0B2 antibody, Nr0b2 antibody, nr0b2a antibody
- Background
- NR0B2 is an unusual orphan receptor that contains a putative ligand-binding domain but lacks a conventional DNA-binding domain. It is a member of the nuclear hormone receptor family, a group of transcription factors regulated by small hydrophobic hormones, a subset of which do not have known ligands and are referred to as orphan nuclear receptors. The protein has been shown to interact with retinoid and thyroid hormone receptors, inhibiting their ligand-dependent transcriptional activation. In addition, interaction with estrogen receptors has been demonstrated, leading to inhibition of function.
- Molecular Weight
- 28 kDa (MW of target protein)
- Pathways
- Nuclear Receptor Transcription Pathway, Positive Regulation of Peptide Hormone Secretion, Intracellular Steroid Hormone Receptor Signaling Pathway, Steroid Hormone Mediated Signaling Pathway
-