NR2F6 antibody (N-Term)

Catalog No. ABIN630502

Product Details anti-NR2F6 Antibody

Target: NR2F6 (Nuclear Receptor Subfamily 2, Group F, Member 6 (NR2F6))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NR2F6 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: NR2 F6 antibody was raised against the N terminal of NR2 6

Purification: Affinity purified

Immunogen: NR2 F6 antibody was raised using the N terminal of NR2 6 corresponding to a region with amino acids AGGYPRAAEDDSASPPGAASDAEPGDEERPGLQVDCVVCGDKSSGKHYGV

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NR2F6 Blocking Peptide, catalog no. 33R-1199, is also available for use as a blocking control in assays to test for specificity of this NR2F6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NR0 6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NR2F6

Target: NR2F6 (Nuclear Receptor Subfamily 2, Group F, Member 6 (NR2F6))

Alternative Name: NR2F6 (NR2F6 Products)

Synonyms: EAR-2 antibody, EAR2 antibody, ERBAL2 antibody, AV090102 antibody, COUP-TF3 antibody, Erbal2 antibody, COUP(II) antibody, NR2F6 antibody, couptf2 antibody, fc94g11 antibody, wu:fc94g11 antibody, zgc:77259 antibody, ear-2 antibody, ear2 antibody, erbal2 antibody, nr2f6l antibody, wu:fc72d04 antibody, zgc:77260 antibody, nuclear receptor subfamily 2 group F member 6 antibody, nuclear receptor subfamily 2, group F, member 6 antibody, nuclear receptor subfamily 2, group F, member 6a antibody, nuclear receptor subfamily 2 group F member 6 L homeolog antibody, nuclear receptor subfamily 2, group F, member 6b antibody, NR2F6 antibody, Nr2f6 antibody, nr2f6a antibody, nr2f6.L antibody, nr2f6 antibody, nr2f6b antibody

Background: Orphan nuclear receptor EAR-2 (NR2F6, V-erbA related protein EAR-2 ) is predicted to be a protein similar in primary structure to receptors for steroid hormones or thyroid hormone (T3).

Molecular Weight: 43 kDa (MW of target protein)

Pathways: Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway, Photoperiodism