NR0B1 antibody (N-Term)

Catalog No. ABIN630505

Product Details anti-NR0B1 Antibody

Target: NR0B1 (Nuclear Receptor Subfamily 0, Group B, Member 1 (NR0B1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NR0B1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: NR0 B1 antibody was raised against the N terminal of NR0 1

Purification: Affinity purified

Immunogen: NR0 B1 antibody was raised using the N terminal of NR0 1 corresponding to a region with amino acids MAGENHQWQGSILYNMLMSAKQTRAAPEAPETRLVDQCWGCSCGDEPGVG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NR0B1 Blocking Peptide, catalog no. 33R-5660, is also available for use as a blocking control in assays to test for specificity of this NR0B1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NR0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NR0B1

Target: NR0B1 (Nuclear Receptor Subfamily 0, Group B, Member 1 (NR0B1))

Alternative Name: NR0B1 (NR0B1 Products)

Synonyms: DAX antibody, NR0B1 antibody, dax1 antibody, AHC antibody, AHCH antibody, AHX antibody, DAX-1 antibody, DAX1 antibody, DSS antibody, GTD antibody, HHG antibody, NROB1 antibody, SRXY2 antibody, Ahc antibody, Ahch antibody, Dax1 antibody, nuclear receptor subfamily 0 group B member 1 antibody, nuclear receptor subfamily 0, group B, member 1 antibody, nuclear receptor subfamily 0 group B member 1 L homeolog antibody, NR0B1 antibody, nr0b1 antibody, nr0b1.L antibody, Nr0b1 antibody

Background: NR0B1 is a protein that contains a DNA-binding domain. The protein acts as a dominant-negative regulator of transcription which is mediated by the retinoic acid receptor. This protein also functions as an anti-testis gene by acting antagonistically to Sry. Mutations in its gene result in both X-linked congenital adrenal hypoplasia and hypogonadotropic hypogonadism.

Molecular Weight: 52 kDa (MW of target protein)

Pathways: Nuclear Receptor Transcription Pathway, Intracellular Steroid Hormone Receptor Signaling Pathway, Steroid Hormone Mediated Signaling Pathway, Regulation of Intracellular Steroid Hormone Receptor Signaling