NR5A1 antibody (Middle Region)

Catalog No. ABIN630507

Product Details anti-NR5A1 Antibody

Target: NR5A1 (Nuclear Receptor Subfamily 5, Group A, Member 1 (NR5A1))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NR5A1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: NR5 A1 antibody was raised against the middle region of NR5 1

Purification: Affinity purified

Immunogen: NR5 A1 antibody was raised using the middle region of NR5 1 corresponding to a region with amino acids SLHGPEPKGLAAGPPAGPLGDFGAPALPMAVPGAHGPLAGYLYPAFPGRA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NR5A1 Blocking Peptide, catalog no. 33R-8589, is also available for use as a blocking control in assays to test for specificity of this NR5A1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NR0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NR5A1

Target: NR5A1 (Nuclear Receptor Subfamily 5, Group A, Member 1 (NR5A1))

Alternative Name: NR5A1 (NR5A1 Products)

Synonyms: AD4BP antibody, ELP antibody, FTZ1 antibody, FTZF1 antibody, POF7 antibody, SF-1 antibody, SF1 antibody, SPGF8 antibody, SRXY3 antibody, Ad4BP antibody, ELP-3 antibody, Ftz-F1 antibody, Ftzf1 antibody, Ad4BP/SF-1 antibody, Ad4bp antibody, Sf-1 antibody, NR5A1 antibody, sf-1 antibody, elp antibody, sf1 antibody, ftz1 antibody, ad4bp antibody, ftzf1 antibody, SF-1/Ad4BP antibody, SI:zC167P9.2 antibody, ff1d antibody, nr5a2l antibody, nuclear receptor subfamily 5 group A member 1 antibody, nuclear receptor subfamily 5, group A, member 1 antibody, nuclear receptor subfamily 5 group A member 1 L homeolog antibody, nuclear receptor subfamily 6 group A member 1 antibody, nuclear receptor subfamily 5, group A, member 1b antibody, NR5A1 antibody, Nr5a1 antibody, nr5a1.L antibody, nr5a1 antibody, NR6A1 antibody, nr5a1b antibody

Background: NR5A1 is an important regulator of steroidogeneis which is present in human skin and its appendages. It plays a role in regulating p450scc expression with TReP-132 and CBP/p300. The protein encoded by this gene is a transcriptional activator involved in sex determination. The encoded protein binds DNA as a monomer. Defects in this gene are a cause of XY sex reversal with or without adrenal failure as well as adrenocortical insufficiency without ovarian defect.

Molecular Weight: 52 kDa (MW of target protein)

Pathways: Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway, Maintenance of Protein Location