DYRK1A antibody

Catalog No. ABIN630535

Product Details anti-DYRK1A Antibody

Target: DYRK1A (Dual-Specificity tyrosine-(Y)-phosphorylation Regulated Kinase 1A (DYRK1A))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DYRK1A antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: DYRK1 A antibody was raised using a synthetic peptide corresponding to a region with amino acids INEVYYAKKKRRHQQGQGDDSSHKKERKVYNDGYDDDNYDYIVKNGEKWM

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DYRK1A Blocking Peptide, catalog no. 33R-4071, is also available for use as a blocking control in assays to test for specificity of this DYRK1A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DYRK0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DYRK1A

Target: DYRK1A (Dual-Specificity tyrosine-(Y)-phosphorylation Regulated Kinase 1A (DYRK1A))

Alternative Name: DYRK1A (DYRK1A Products)

Synonyms: DYRK1A antibody, dyrk antibody, dyrk1 antibody, hp86 antibody, mnb antibody, mnbh antibody, DYRK antibody, DYRK1 antibody, HP86 antibody, MNB antibody, MNBH antibody, MRD7 antibody, 2310043O08Rik antibody, D16Ertd272e antibody, D16Ertd493e antibody, Dyrk antibody, ENSMUSG00000074897 antibody, Gm10783 antibody, Mnbh antibody, Mp86 antibody, mmb antibody, PSK47 antibody, dual specificity tyrosine phosphorylation regulated kinase 1A antibody, dual specificity tyrosine-(Y)-phosphorylation regulated kinase 1A antibody, dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1a antibody, dual specificity tyrosine-(Y)-phosphorylation regulated kinase 1A S homeolog antibody, DYRK1A antibody, dyrk1a antibody, Dyrk1a antibody, dyrk1a.S antibody

Background: This gene encodes a member of the Dual-specificity tyrosine phosphorylation-regulated kinase (DYRK) family. This member contains a nuclear targeting signal sequence, a protein kinase domain, a leucine zipper motif, and a highly conservative 13-consecutive-histidine repeat. It catalyzes its autophosphorylation on serine/threonine and tyrosine residues. It may play a significant role in a signaling pathway regulating cell proliferation and may be involved in brain development.

Molecular Weight: 85 kDa (MW of target protein)

Pathways: Mitotic G1-G1/S Phases