PSMG1 antibody

Catalog No. ABIN630540

Product Details anti-PSMG1 Antibody

Target: PSMG1 (Proteasome (Prosome, Macropain) Assembly Chaperone 1 (PSMG1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PSMG1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: PSMG1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VMKLDLITVEAFKPILSTRSLKGLVKNIPQSTEILKKLMTTNEIQSNIYT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PSMG1 Blocking Peptide, catalog no. 33R-9697, is also available for use as a blocking control in assays to test for specificity of this PSMG1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSMG1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PSMG1

Target: PSMG1 (Proteasome (Prosome, Macropain) Assembly Chaperone 1 (PSMG1))

Alternative Name: PSMG1 (PSMG1 Products)

Synonyms: DSCR2 antibody, dscr2 antibody, zgc:91806 antibody, wu:fl12g04 antibody, wu:fu18c08 antibody, PSMG1 antibody, pac1 antibody, c21lrp antibody, lrpc21 antibody, DDBDRAFT_0206024 antibody, DDBDRAFT_0304546 antibody, DDB_0206024 antibody, DDB_0304546 antibody, C21LRP antibody, LRPC21 antibody, PAC-1 antibody, PAC1 antibody, AW552102 antibody, Dscr2 antibody, proteasome assembly chaperone 1 antibody, proteasome (prosome, macropain) assembly chaperone 1 antibody, proteasome (prosome, macropain) assembly chaperone 1 L homeolog antibody, PSMG1 antibody, psmg1 antibody, psmg1.L antibody, psmG1 antibody, Psmg1 antibody

Background: PSMG1 is a chaperone protein which promotes assembly of the 20S proteasome as part of a heterodimer with PSMG2. The PSMG1-PSMG2 heterodimer binds to the PSMA5 and PSMA7 proteasome subunits, promotes assembly of the proteasome alpha subunits into the heteroheptameric alpha ring and prevents alpha ring dimerization.

Molecular Weight: 33 kDa (MW of target protein)