WNT16 antibody (Middle Region)
-
- Target See all WNT16 Antibodies
- WNT16 (Wingless-Type MMTV Integration Site Family, Member 16 (WNT16))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This WNT16 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- WNT16 antibody was raised against the middle region of WNT16
- Purification
- Affinity purified
- Immunogen
- WNT16 antibody was raised using the middle region of WNT16 corresponding to a region with amino acids KTKRKMRRREKDQRKIPIHKDDLLYVNKSPNYCVEDKKLGIPGTQGRECN
- Top Product
- Discover our top product WNT16 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
WNT16 Blocking Peptide, catalog no. 33R-4682, is also available for use as a blocking control in assays to test for specificity of this WNT16 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WNT16 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- WNT16 (Wingless-Type MMTV Integration Site Family, Member 16 (WNT16))
- Alternative Name
- WNT16 (WNT16 Products)
- Synonyms
- zgc:77293 antibody, E130309I19Rik antibody, Wnt family member 16 antibody, wingless-type MMTV integration site family, member 16 antibody, WNT16 antibody, wnt16 antibody, Wnt16 antibody
- Background
- WNT proteins are secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. WNT16 contains two transcript variants diverging at the 5' termini. These two variants are proposed to be the products of separate promoters and not to be splice variants from a single promoter. They are differentially expressed in normal tissues, one of which (variant 2) is expressed at significant levels only in the pancreas, whereas another one (variant 1) is expressed more ubiquitously with highest levels in adult kidney, placenta, brain, heart, and spleen.
- Molecular Weight
- 40 kDa (MW of target protein)
- Pathways
- WNT Signaling
-