TNPO2 antibody

Catalog No. ABIN630589

Product Details anti-TNPO2 Antibody

Target: TNPO2 (Transportin 2 (TNPO2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TNPO2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: Transportin 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LVQKTLAQAMMYTQHPEQYEAPDKDFMIVALDLLSGLAEGLGGHVEQLVA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Transportin 2 Blocking Peptide, catalog no. 33R-5534, is also available for use as a blocking control in assays to test for specificity of this Transportin 2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TNPO2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TNPO2

Target: TNPO2 (Transportin 2 (TNPO2))

Alternative Name: Transportin 2 (TNPO2 Products)

Synonyms: TNPO2 antibody, IPO3 antibody, KPNB2B antibody, TRN2 antibody, ik:tdsubc_2a7 antibody, tdsubc_2a7 antibody, wu:fb01c02 antibody, wu:fe01f03 antibody, wu:fe16e12 antibody, xx:tdsubc_2a7 antibody, zgc:101009 antibody, 1110034O24Rik antibody, AA414969 antibody, AI464345 antibody, AI852433 antibody, Knpb2b antibody, Kpnb2b antibody, transportin 2 antibody, transportin 2 L homeolog antibody, transportin 2 (importin 3, karyopherin beta 2b) antibody, TNPO2 antibody, tnpo2.L antibody, Tnpo2 antibody, tnpo2 antibody

Background: Transportin-2 (TNPO2) mediates nuclear import of HuR protein in vitro. It also participates in mRNA export from the nucleus.

Molecular Weight: 100 kDa (MW of target protein)