MBD3 antibody (N-Term)

Catalog No. ABIN630599

Product Details anti-MBD3 Antibody

Target: MBD3 (Methyl-CpG Binding Domain Protein 3 (MBD3))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MBD3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MBD3 antibody was raised against the N terminal of MBD3

Purification: Affinity purified

Immunogen: MBD3 antibody was raised using the N terminal of MBD3 corresponding to a region with amino acids SKMNKSRQRVRYDSSNQVKGKPDLNTALPVRQTASIFKQPVTKITNHPSN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MBD3 Blocking Peptide, catalog no. 33R-8560, is also available for use as a blocking control in assays to test for specificity of this MBD3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MBD3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MBD3

Target: MBD3 (Methyl-CpG Binding Domain Protein 3 (MBD3))

Alternative Name: MBD3 (MBD3 Products)

Synonyms: xmbd3 antibody, MGC69548 antibody, MBD3 antibody, DKFZp459N1635 antibody, AI181826 antibody, AU019209 antibody, methyl-CpG binding domain protein 3 S homeolog antibody, methyl-CpG binding domain protein 3 antibody, mbd3.S antibody, mbd3 antibody, MBD3 antibody, Mbd3 antibody

Background: DNA methylation is the major modification of eukaryotic genomes and plays an essential role in mammalian development. Human proteins MECP2, MBD1, MBD2, MBD3, and MBD4 comprise a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD).

Molecular Weight: 33 kDa (MW of target protein)

Pathways: Chromatin Binding