CRYGC antibody (Middle Region)

Catalog No. ABIN630603

Product Details anti-CRYGC Antibody

Target: CRYGC (Crystallin, gamma C (CRYGC))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CRYGC antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Crystallin Gamma C antibody was raised against the middle region of CRYGC

Purification: Affinity purified

Immunogen: Crystallin Gamma C antibody was raised using the middle region of CRYGC corresponding to a region with amino acids GLSDSIRSCCLIPQTVSHRLRLYEREDHKGLMMELSEDCPSIQDRFHLSE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Crystallin Gamma C Blocking Peptide, catalog no. 33R-3422, is also available for use as a blocking control in assays to test for specificity of this Crystallin Gamma C antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CRYGC antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CRYGC

Target: CRYGC (Crystallin, gamma C (CRYGC))

Alternative Name: Crystallin gamma C (CRYGC Products)

Synonyms: Cryg antibody, Cryg3 antibody, Len antibody, CCL antibody, CRYG3 antibody, CTRCT2 antibody, Cryg-5 antibody, ccl antibody, cryg3 antibody, MGC84008 antibody, CRYGC antibody, crystallin, gamma C antibody, crystallin gamma C antibody, crystallin gamma C L homeolog antibody, gamma-crystallin C antibody, Crygc antibody, CRYGC antibody, crygc.L antibody, LOC100069179 antibody

Background: Crystallins are separated into two classes: taxon-specific, or enzyme, and ubiquitous. The latter class constitutes the major proteins of vertebrate eye lens and maintains the transparency and refractive index of the lens. Since lens central fiber cells lose their nuclei during development, these crystallins are made and then retained throughout life, making them extremely stable proteins. Mammalian lens crystallins are divided into alpha, beta, and gamma families, Gamma-crystallins are a homogeneous group of highly symmetrical, monomeric proteins typically lacking connecting peptides and terminal extensions. They are differentially regulated after early development. Four gamma-crystallin genes (gamma-A through gamma-D) and three pseudogenes (gamma-E, gamma-F, gamma-G) are tandemly organized in a genomic segment as a gene cluster. Whether due to aging or mutations in specific genes, gamma-crystallins have been involved in cataract formation.

Molecular Weight: 21 kDa (MW of target protein)