TXNIP antibody (C-Term)

Catalog No. ABIN630604

Product Details anti-TXNIP Antibody

Target: TXNIP (Thioredoxin Interacting Protein (TXNIP))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TXNIP antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TXNIP antibody was raised against the C terminal of TXNIP

Purification: Affinity purified

Immunogen: TXNIP antibody was raised using the C terminal of TXNIP corresponding to a region with amino acids DTPEAPPCYMDVIPEDHRLESPTTPLLDDMDGSQDSPIFMYAPEFKFMPP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TXNIP Blocking Peptide, catalog no. 33R-2201, is also available for use as a blocking control in assays to test for specificity of this TXNIP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TXNIP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TXNIP

Target: TXNIP (Thioredoxin Interacting Protein (TXNIP))

Alternative Name: TXNIP (TXNIP Products)

Synonyms: EST01027 antibody, HHCPA78 antibody, THIF antibody, VDUP1 antibody, Gm348 antibody, Trf3 antibody, TBP2 antibody, TRF3 antibody, 1200008J08Rik antibody, AA682105 antibody, Hyplip1 antibody, Tbp-2 antibody, Vdup1 antibody, sb:cb368 antibody, txnip antibody, thioredoxin interacting protein antibody, TATA box binding protein like 2 antibody, TATA-box binding protein like 2 antibody, thioredoxin interacting protein L homeolog antibody, thioredoxin interacting protein a antibody, TXNIP antibody, Tbpl2 antibody, TBPL2 antibody, Txnip antibody, txnip.L antibody, txnip antibody, txnipa antibody

Background: TXNIP may act as an oxidative stress mediator by inhibiting thioredoxin activity or by limiting its bioavailability. It interacts with COPS5 and restores COPS5-induced suppression of CDKN1B stability, blocking the COPS5-mediated translocation of CDKN1B from the nucleus to the cytoplasm. It functions as a transcriptional repressor, possibly by acting as a bridge molecule between transcription factors and corepressor complexes, and over-expression will induce G0/G1 cell cycle arrest. It is required for the maturation of natural killer cells.

Molecular Weight: 44 kDa (MW of target protein)

Pathways: Protein targeting to Nucleus, Platelet-derived growth Factor Receptor Signaling, Inflammasome