GNAL antibody
-
- Target See all GNAL Antibodies
- GNAL (Guanine Nucleotide Binding Protein, alpha Stimulating, Olfactory Type (GNAL))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GNAL antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- GNAL antibody was raised using a synthetic peptide corresponding to a region with amino acids AEKVLAGKSKIEDYFPEYANYTVPEDATPDAGEDPKVTRAKFFIRDLFLR
- Top Product
- Discover our top product GNAL Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GNAL Blocking Peptide, catalog no. 33R-1134, is also available for use as a blocking control in assays to test for specificity of this GNAL antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GNAL antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GNAL (Guanine Nucleotide Binding Protein, alpha Stimulating, Olfactory Type (GNAL))
- Alternative Name
- GNAL (GNAL Products)
- Synonyms
- DYT25 antibody, zgc:103521 antibody, 2610011C15Rik antibody, 9630020G10Rik antibody, AI843190 antibody, Galphaolf antibody, Gna10 antibody, Golf antibody, Olf antibody, RGD1305940 antibody, G protein subunit alpha L antibody, guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type antibody, guanine nucleotide binding protein, alpha stimulating, olfactory type antibody, GNAL antibody, gnal antibody, Gnal antibody
- Background
- Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. G(olf) alpha mediates signal transduction within the olfactory neuroepithelium and the basal ganglia. It may be involved in some aspect of visual transduction, and in mediating the effect of one or more hormones/neurotransmitters.
- Molecular Weight
- 50 kDa (MW of target protein)
-