PRMT2 antibody (N-Term)

Catalog No. ABIN630635

Product Details anti-PRMT2 Antibody

Target: PRMT2 (Protein Arginine Methyltransferase 2 (PRMT2))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PRMT2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PRMT2 antibody was raised against the N terminal of PRMT2

Purification: Affinity purified

Immunogen: PRMT2 antibody was raised using the N terminal of PRMT2 corresponding to a region with amino acids ERAGCCGYIPANHVGKHVDEYDPEDTWQDEEYFGSYGTLKLHLEMLADQP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PRMT2 Blocking Peptide, catalog no. 33R-2686, is also available for use as a blocking control in assays to test for specificity of this PRMT2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRMT2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PRMT2

Target: PRMT2 (Protein Arginine Methyltransferase 2 (PRMT2))

Alternative Name: PRMT2 (PRMT2 Products)

Synonyms: PRMT2 antibody, DKFZp459N1919 antibody, HRMT1L1 antibody, Hrmt1l1 antibody, AI504737 antibody, protein arginine methyltransferase 2 antibody, protein arginine methyltransferase 2 L homeolog antibody, protein arginine N-methyltransferase 2 antibody, PRMT2 antibody, Prmt2 antibody, prmt2.L antibody

Background: The protein arginine methyltransferases (PRMTs) include a family of proteins with related putative methyltransferase domains that modify chromatin and regulate cellular transcription. PRMT2 inhibits NF-kappaB-dependent transcription and promotes apoptosis and it exerts this effect by blocking nuclear export of IkappaB-alpha through a leptomycin-sensitive pathway, increasing nuclear IkappaB-alpha and decreasing NF-kappaB DNA binding. PRMT2 also rendered cells susceptible to apoptosis by cytokines or cytotoxic drugs, likely due to its effects on NF-kappaB.

Molecular Weight: 49 kDa (MW of target protein)

Pathways: Intracellular Steroid Hormone Receptor Signaling Pathway, Regulation of Intracellular Steroid Hormone Receptor Signaling, Nuclear Hormone Receptor Binding