QTRTD1 antibody (N-Term)

Catalog No. ABIN630639

Product Details anti-QTRTD1 Antibody

Target: QTRTD1 (Queuine tRNA-Ribosyltransferase Domain Containing 1 (QTRTD1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This QTRTD1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: QTRTD1 antibody was raised against the N terminal of QTRTD1

Purification: Affinity purified

Immunogen: QTRTD1 antibody was raised using the N terminal of QTRTD1 corresponding to a region with amino acids YTKTGSAPHLTHHTLHNIHGVPAMAQLTLSSLAEHHEVLTEYKEGVGKFI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

QTRTD1 Blocking Peptide, catalog no. 33R-10263, is also available for use as a blocking control in assays to test for specificity of this QTRTD1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of QTRTD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for QTRTD1

Target: QTRTD1 (Queuine tRNA-Ribosyltransferase Domain Containing 1 (QTRTD1))

Alternative Name: QTRTD1 (QTRTD1 Products)

Synonyms: 3110012M05Rik antibody, 4930470H18Rik antibody, AI648807 antibody, queuine tRNA-ribosyltransferase accessory subunit 2 antibody, queuine tRNA-ribosyltransferase accessory subunit 2 L homeolog antibody, QTRT2 antibody, qtrt2 antibody, qtrt2.L antibody, Qtrt2 antibody

Background: QTRTD1 belongs to the queuine tRNA-ribosyltransferase family. The function of the QTRTD1 protein remains unknown.

Molecular Weight: 47 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process