FRS3 antibody (Middle Region)

Catalog No. ABIN630650

Product Details anti-FRS3 Antibody

Target: FRS3 (Fibroblast Growth Factor Receptor Substrate 3 (FRS3))

Binding Specificity: Middle Region

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FRS3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FRS3 antibody was raised against the middle region of FRS3

Purification: Affinity purified

Immunogen: FRS3 antibody was raised using the middle region of FRS3 corresponding to a region with amino acids GFPDGEEDETPLQKPTSTRAAIRSHGSFPVPLTRRRGSPRVFNFDFRRPG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FRS3 Blocking Peptide, catalog no. 33R-3263, is also available for use as a blocking control in assays to test for specificity of this FRS3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FRS3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FRS3

Target: FRS3 (Fibroblast Growth Factor Receptor Substrate 3 (FRS3))

Alternative Name: FRS3 (FRS3 Products)

Synonyms: MGC82242 antibody, snt2 antibody, frs2b antibody, snt-2 antibody, frs2beta antibody, FRS2-beta antibody, FRS2B antibody, FRS2beta antibody, SNT-2 antibody, SNT2 antibody, 4930417B13Rik antibody, AI449674 antibody, Frs2beta antibody, Snt2 antibody, fibroblast growth factor receptor substrate 3 S homeolog antibody, fibroblast growth factor receptor substrate 3 antibody, frs3.S antibody, FRS3 antibody, frs3 antibody, Frs3 antibody

Background: FRS3 is an adapter protein that links FGR and NGF receptors to downstream signaling pathways. FRS3 is involved in the activation of MAP kinases. FRS3 down-regulates ERK2 signaling by interfering with the phosphorylation and nuclear translocation of ERK2.

Molecular Weight: 54 kDa (MW of target protein)