HIPK1 antibody (Middle Region)

Catalog No. ABIN630651

Product Details anti-HIPK1 Antibody

Target: HIPK1 (Homeodomain Interacting Protein Kinase 1 (HIPK1))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HIPK1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: HIPK1 antibody was raised against the middle region of HIPK1

Purification: Affinity purified

Immunogen: HIPK1 antibody was raised using the middle region of HIPK1 corresponding to a region with amino acids PLNLSQNQQSSAAPTSQERSSNPAPRRQQAFVAPLSQAPYTFQHGSPLHS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HIPK1 Blocking Peptide, catalog no. 33R-7200, is also available for use as a blocking control in assays to test for specificity of this HIPK1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HIPK1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HIPK1

Target: HIPK1 (Homeodomain Interacting Protein Kinase 1 (HIPK1))

Alternative Name: HIPK1 (HIPK1 Products)

Synonyms: HIPK1 antibody, myak antibody, nbak2 antibody, hipk1 antibody, Myak antibody, Nbak2 antibody, 1110062K04Rik antibody, homeodomain interacting protein kinase 1 antibody, homeodomain interacting protein kinase 1 L homeolog antibody, homeodomain interacting protein kinase 1 S homeolog antibody, HIPK1 antibody, hipk1.L antibody, hipk1 antibody, hipk1.S antibody, Hipk1 antibody

Background: HIPK1 may play a role as a corepressor for homeodomain transcription factors. HIPK1 phosphorylates DAXX in response to stress, and mediates its translocation from the nucleus to the cytoplasm. HIPK1 may be involved in malignant squamous cell tumor formation.

Molecular Weight: 131 kDa (MW of target protein)