PPAT antibody (N-Term)

Catalog No. ABIN630652

Product Details anti-PPAT Antibody

Target: PPAT (Phosphoribosyl Pyrophosphate Amidotransferase (PPAT))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PPAT antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: PPAT antibody was raised against the N terminal of PPAT

Purification: Affinity purified

Immunogen: PPAT antibody was raised using the N terminal of PPAT corresponding to a region with amino acids VTSDGSSVPTFKSHKGMGLVNHVFTEDNLKKLYVSNLGIGHTRYATTGKC

Application Details

Application Notes: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PPAT Blocking Peptide, catalog no. 33R-9857, is also available for use as a blocking control in assays to test for specificity of this PPAT antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPAT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PPAT

Target: PPAT (Phosphoribosyl Pyrophosphate Amidotransferase (PPAT))

Alternative Name: PPAT (PPAT Products)

Synonyms: ATASE antibody, GPAT antibody, PRAT antibody, Atase antibody, 5730454C12Rik antibody, AA408689 antibody, AA675351 antibody, AI507113 antibody, C79945 antibody, im:6894693 antibody, si:dkeyp-117h8.5 antibody, wu:fb61f03 antibody, wu:fc28b09 antibody, phosphoribosyl pyrophosphate amidotransferase antibody, phosphoribosyl pyrophosphate amidotransferase L homeolog antibody, PPAT antibody, Ppat antibody, ppat.L antibody, ppat antibody

Background: PPAT is a member of the purine/pyrimidine phosphoribosyltransferase family. This protein is a regulatory allosteric enzyme that catalyzes the first step of de novo purine nucleotide biosynthesis. Its gene and PAICS/AIRC, a bifunctional enzyme catalyzing steps six and seven in the purine nucleotide biosynthesis pathway, are located in close proximity on chromosome 4.

Molecular Weight: 56 kDa (MW of target protein)