SLA antibody (Middle Region)

Catalog No. ABIN630654

Product Details anti-SLA Antibody

Target: SLA (Src-Like-Adaptor (SLA))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLA antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SLA1 antibody was raised against the middle region of SLA

Purification: Affinity purified

Immunogen: SLA1 antibody was raised using the middle region of SLA corresponding to a region with amino acids PEGTENPLGVDESLFSYGLRESIASYLSLTSEDNTSFDRKKKSISLMYGG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLA1 Blocking Peptide, catalog no. 33R-7045, is also available for use as a blocking control in assays to test for specificity of this SLA1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLA

Target: SLA (Src-Like-Adaptor (SLA))

Alternative Name: SLA1 (SLA Products)

Synonyms: SLA1 antibody, SLAP antibody, src-like-adapter antibody, SLA antibody, Slap1 antibody, Slap antibody, Slap-1 antibody, Src like adaptor antibody, Src-like-adaptor antibody, src-like adaptor antibody, SLA antibody, Sla antibody

Background: SLA is an adapter protein, which negatively regulates T-cell receptor (TCR) signaling. SLA inhibits T-cell antigen-receptor induced activation of nuclear factor of activated T-cells.

Molecular Weight: 31 kDa (MW of target protein)