KPNA3 antibody

Catalog No. ABIN630663

Product Details anti-KPNA3 Antibody

Target: KPNA3 (Karyopherin alpha 3 (Importin alpha 4) (KPNA3))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KPNA3 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: Karyopherin Alpha 3 antibody was raised using a synthetic peptide corresponding to a region with amino acids AENPSLENHRIKSFKNKGRDVETMRRHRNEVTVELRKNKRDEHLLKKRNV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Karyopherin Alpha 3 Blocking Peptide, catalog no. 33R-1141, is also available for use as a blocking control in assays to test for specificity of this Karyopherin Alpha 3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KPNA3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KPNA3

Target: KPNA3 (Karyopherin alpha 3 (Importin alpha 4) (KPNA3))

Alternative Name: Karyopherin alpha 3 (KPNA3 Products)

Synonyms: IPOA4 antibody, si:dz79f24.2 antibody, importin antibody, SRP1 antibody, SRP1gamma antibody, SRP4 antibody, hSRP1 antibody, ipoa4 antibody, srp1 antibody, srp1gamma antibody, srp4 antibody, karyopherin (importin) alpha 3 antibody, karyopherin alpha 3 (importin alpha 4) antibody, karyopherin subunit alpha 3 antibody, karyopherin alpha 3 (importin alpha 4) L homeolog antibody, Kpna3 antibody, kpna3 antibody, KPNA3 antibody, kpna3.L antibody

Background: The transport of molecules between the nucleus and the cytoplasm in eukaryotic cells is mediated by the nuclear pore complex (NPC) which consists of 60-100 proteins and is probably 120 million daltons in molecular size. Small molecules (up to 70 kDa) can pass through the nuclear pore by nonselective diffusion, larger molecules are transported by an active process. Most nuclear proteins contain short basic amino acid sequences known as nuclear localization signals (NLSs). KPNA3 is a protein similar to certain nuclear transport proteins of Xenopus and human.

Molecular Weight: 58 kDa (MW of target protein)

Pathways: Protein targeting to Nucleus